PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Itr_sc001868.1_g00005.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Convolvulaceae; Ipomoeeae; Ipomoea
Family NAC
Protein Properties Length: 356aa    MW: 39943.9 Da    PI: 7.6339
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Itr_sc001868.1_g00005.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM169.31.2e-52141411128
                      NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkat 86 
                              + pGfrFhPtdeelv +yLk+k+++++l++ e ik+vdiyk++PwdLpk ++++ekewyf+++rd+ky+++ r+nr+t +g+Wkat
  Itr_sc001868.1_g00005.1  14 MLPGFRFHPTDEELVGFYLKRKIQQRPLPI-ELIKQVDIYKYDPWDLPKLATTGEKEWYFYCPRDRKYRNSARPNRVTGAGFWKAT 98 
                              579***************************.89***************8888999******************************* PP

                      NAM  87 gkdkevlsk.kgelvglkktLvfykgrapkgektdWvmheyrl 128
                              g+d++++s+ +++ +glkk+Lvfy+gra kg ktdW+mhe+rl
  Itr_sc001868.1_g00005.1  99 GTDRPIYSSeGTKCIGLKKSLVFYRGRAAKGLKTDWMMHEFRL 141
                              ********956667***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019416.67E-5913175IPR003441NAC domain
PROSITE profilePS5100557.114175IPR003441NAC domain
PfamPF023651.0E-2516141IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 356 aa     Download sequence    Send to blast
MGSIMDDKII DDVMLPGFRF HPTDEELVGF YLKRKIQQRP LPIELIKQVD IYKYDPWDLP  60
KLATTGEKEW YFYCPRDRKY RNSARPNRVT GAGFWKATGT DRPIYSSEGT KCIGLKKSLV  120
FYRGRAAKGL KTDWMMHEFR LPTTPAPPPP PTNKFSGHNN FPPNDSWAIC RIFKKTSSMA  180
NRANFAHPWV NNILSEAPPE TLFNQFGSEN IMSSSSSITP LQLSTNNELQ HFSAPPLNNI  240
IPTYKPSSSS LFSNHHSPSS PSSTPSPELP SCSNFMAPSS SSSLSQAASV LFDVTPPTLF  300
SPLNNTATSD HFEQSQHMED DDEVVGLGNI RAMGFPFSLA SEPWKQSSFS WDSPTY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A7e-5411784168NO APICAL MERISTEM PROTEIN
1ut4_B7e-5411784168NO APICAL MERISTEM PROTEIN
1ut7_A7e-5411784168NO APICAL MERISTEM PROTEIN
1ut7_B7e-5411784168NO APICAL MERISTEM PROTEIN
3swm_A7e-5411787171NAC domain-containing protein 19
3swm_B7e-5411787171NAC domain-containing protein 19
3swm_C7e-5411787171NAC domain-containing protein 19
3swm_D7e-5411787171NAC domain-containing protein 19
3swp_A7e-5411787171NAC domain-containing protein 19
3swp_B7e-5411787171NAC domain-containing protein 19
3swp_C7e-5411787171NAC domain-containing protein 19
3swp_D7e-5411787171NAC domain-containing protein 19
4dul_A7e-5411784168NAC domain-containing protein 19
4dul_B7e-5411784168NAC domain-containing protein 19
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016562276.11e-133PREDICTED: putative NAC domain-containing protein 94
SwissprotQ9ZVH03e-99FEZ_ARATH; Protein FEZ
TrEMBLK4BBU81e-131K4BBU8_SOLLC; Uncharacterized protein
STRINGSolyc02g087920.2.11e-130(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA22022262
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G26870.12e-98NAC family protein